PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P15910_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 154aa    MW: 18281.9 Da    PI: 8.8793
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P15910_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-194498256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           r++ ++++eql  Le+ F+ ++++ ++e++eLA++l+L+ rqV vWFqNrRa++k
  GSMUA_Achr7P15910_001 44 RRKLRLSEEQLSLLEDSFRAHNTLAHDEKRELAQRLHLQPRQVEVWFQNRRARRK 98
                           567789***********************************************98 PP

2HD-ZIP_I/II113.61.2e-3644132189
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ++k+rls+eq++lLE+sF+++++L +++K ela++L+lqprqv+vWFqnrRAR k+kq+E+d+e+L++++++l++en+rL++e  eLr
  GSMUA_Achr7P15910_001  44 RRKLRLSEEQLSLLEDSFRAHNTLAHDEKRELAQRLHLQPRQVEVWFQNRRARRKLKQTEEDCESLRKCCQRLTNENRRLKRELMELR 131
                            59*************************************************************************************9 PP

            HD-ZIP_I/II  89 e 89 
                            +
  GSMUA_Achr7P15910_001 132 A 132
                            6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.7540100IPR001356Homeobox domain
SMARTSM003896.9E-1742104IPR001356Homeobox domain
SuperFamilySSF466893.22E-1843109IPR009057Homeodomain-like
CDDcd000863.97E-1244101No hitNo description
PfamPF000462.0E-164498IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-174998IPR009057Homeodomain-like
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PfamPF021831.0E-8100132IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-10100143IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MIQEEECDVV LRLAVGGGEK TPVREISERL MRPANEREEA EGTRRKLRLS EEQLSLLEDS  60
FRAHNTLAHD EKRELAQRLH LQPRQVEVWF QNRRARRKLK QTEEDCESLR KCCQRLTNEN  120
RRLKRELMEL RAARLITCSS CEKIARDEKK TINS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
192100RRARRKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409756.11e-106PREDICTED: homeobox-leucine zipper protein HOX18-like
SwissprotA2X6747e-41HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLM0THX81e-106M0THX8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P15910_0011e-105(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-29HD-ZIP family protein